DCP1B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179422

Catalog No. NBP179422

Description

DCP1B Polyclonal specifically detects DCP1B in Human samples. It is validated for Western Blot.

Specifications

• Antigen: DCP1B
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DCP1, DCP1 decapping enzyme homolog B (S. cerevisiae), decapping enzyme hDcp1b, EC 3.-, FLJ31638, hDcp1b, mRNA-decapping enzyme 1B
• Host Species: Rabbit
• Molecular Weight of Antigen: 68 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: Guinea pig: 86%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_689853
• Gene Symbols: DCP1B
• Immunogen: Synthetic peptide directed towards the N terminal of human DCP1BThe immunogen for this antibody is DCP1B. Peptide sequence TLDPEPQHLSLTALFGKQDKATCQETVEPPQTLHQQQQQQQQQQEKLPIR.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 196513
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.