Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DCP1B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | DCP1B |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
DCP1B Polyclonal specifically detects DCP1B in Human samples. It is validated for Western Blot.Specifications
DCP1B | |
Polyclonal | |
Rabbit | |
NP_689853 | |
196513 | |
Synthetic peptide directed towards the N terminal of human DCP1BThe immunogen for this antibody is DCP1B. Peptide sequence TLDPEPQHLSLTALFGKQDKATCQETVEPPQTLHQQQQQQQQQQEKLPIR. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
DCP1, DCP1 decapping enzyme homolog B (S. cerevisiae), decapping enzyme hDcp1b, EC 3.-, FLJ31638, hDcp1b, mRNA-decapping enzyme 1B | |
DCP1B | |
IgG | |
68 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title