Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DCP1B Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | DCP1B |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179422
|
Novus Biologicals
NBP179422 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
DCP1B Polyclonal specifically detects DCP1B in Human samples. It is validated for Western Blot.Specifications
| DCP1B | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| DCP1, DCP1 decapping enzyme homolog B (S. cerevisiae), decapping enzyme hDcp1b, EC 3.-, FLJ31638, hDcp1b, mRNA-decapping enzyme 1B | |
| DCP1B | |
| IgG | |
| Affinity Purified | |
| 68 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_689853 | |
| 196513 | |
| Synthetic peptide directed towards the N terminal of human DCP1BThe immunogen for this antibody is DCP1B. Peptide sequence TLDPEPQHLSLTALFGKQDKATCQETVEPPQTLHQQQQQQQQQQEKLPIR. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title