Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DCP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15744120UL
Description
DCP2 Polyclonal specifically detects DCP2 in Human samples. It is validated for Western Blot.Specifications
DCP2 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q8IU60 | |
DCP2 | |
Synthetic peptides corresponding to DCP2(DCP2 decapping enzyme homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of DCP2. Peptide sequence KQYQDSPNQKKRTNGLQPAKQQNSLMKCEKKLHPRKLQDNFETDAVYDLP. | |
Affinity Purified | |
RUO | |
167227 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
DCP2 decapping enzyme homolog (S. cerevisiae), EC 3.-, FLJ33245, hDpc, mRNA-decapping enzyme 2, nudix (nucleoside diphosphate linked moiety X)-type motif 20, Nudix motif 20, NUDT20Nucleoside diphosphate-linked moiety X motif 20 | |
Rabbit | |
52 kDa | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction