Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DCP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $499.50
Specifications
Antigen | DCP2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP1574420
![]() |
Novus Biologicals
NBP15744120UL |
20 μL |
Each for $206.00
|
|
|||||
NBP157441
![]() |
Novus Biologicals
NBP157441 |
100 μL |
Each for $499.50
|
|
|||||
Description
DCP2 Polyclonal specifically detects DCP2 in Human samples. It is validated for Western Blot.Specifications
DCP2 | |
Polyclonal | |
Rabbit | |
Q8IU60 | |
167227 | |
Synthetic peptides corresponding to DCP2(DCP2 decapping enzyme homolog (S. cerevisiae)) The peptide sequence was selected from the middle region of DCP2. Peptide sequence KQYQDSPNQKKRTNGLQPAKQQNSLMKCEKKLHPRKLQDNFETDAVYDLP. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
DCP2 decapping enzyme homolog (S. cerevisiae), EC 3.-, FLJ33245, hDpc, mRNA-decapping enzyme 2, nudix (nucleoside diphosphate linked moiety X)-type motif 20, Nudix motif 20, NUDT20Nucleoside diphosphate-linked moiety X motif 20 | |
DCP2 | |
IgG | |
52 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title