DCPS Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256249

Catalog No. NBP256249

Description

DCPS Polyclonal specifically detects DCPS in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: DCPS
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: DCS1, DCS-1, decapping enzyme, scavenger, EC 3.-, heat shock-like protein 1, HINT5, HINT-5homolog of C. elegans 7meGMP-directed hydrolase dcs-1, Hint-related 7meGMP-directed hydrolase, Histidine triad protein member 5, HSL1, HSPC015, mRNA decapping enzyme, scavenger mRNA-decapping enzyme DcpS
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: DCPS
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QFSNDIYSTYHLFPPRQLNDVKTTVVYPATEKHLQKYLRQDLRLIRETGDDYRNITLPHLESQSLSIQWVY
• Quantity: 100 μL
• Research Discipline: Stem Cell Markers
• Gene ID (Entrez): 28960
• Target Species: Human
• Isotype: IgG

For Research Use Only