DCUN1D1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156537

Catalog No. NBP156537

Description

DCUN1D1 Polyclonal specifically detects DCUN1D1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: DCUN1D1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae), DCN1-like protein 1, DCUN1L1DCUN1 domain-containing protein 1, Defective in cullin neddylation protein 1-like protein 1, RP42 homolog, RP42Squamous cell carcinoma-related oncogene, SCCROSCRO, Tes3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Chicken: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q96GG9
• Gene Symbols: DCUN1D1
• Immunogen: Synthetic peptides corresponding to DCUN1D1(DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae)) The peptide sequence was selected from the N terminal of DCUN1D1. Peptide sequence SQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENK The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 54165
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only