Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DCUN1D3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP155423
Description
DCUN1D3 Polyclonal specifically detects DCUN1D3 in Human samples. It is validated for Western Blot.Specifications
DCUN1D3 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
DCN1, defective in cullin neddylation 1, domain containing 3 (S. cerevisiae), DCN1-like protein 3, DCUN1 domain-containing protein 3, Defective in cullin neddylation protein 1-like protein 3, DKFZp686O0290, FLJ41725,44M2.4, MGC48972 | |
Rabbit | |
34 kDa | |
100 μL | |
Primary | |
Zebrafish: 86%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q8IWE4 | |
DCUN1D3 | |
Synthetic peptides corresponding to DCUN1D3(DCN1, defective in cullin neddylation 1, domain containing 3 (S. cerevisiae)) The peptide sequence was selected from the C terminal of DCUN1D3. Peptide sequence LNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLSNYSEDEAWPSLFDTFV The peptide sequence for this immunogen was taken from within the described region. | |
Affinity purified | |
RUO | |
123879 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction