Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DCUN1D3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15542320UL
Description
DCUN1D3 Polyclonal specifically detects DCUN1D3 in Human samples. It is validated for Western Blot.Specifications
| DCUN1D3 | |
| Polyclonal | |
| Western Blot 1:100-1:2000 | |
| Q8IWE4 | |
| DCUN1D3 | |
| Synthetic peptides corresponding to DCUN1D3(DCN1, defective in cullin neddylation 1, domain containing 3 (S. cerevisiae)) The peptide sequence was selected from the C terminal of DCUN1D3. Peptide sequence LNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLS | |
| Affinity Purified | |
| RUO | |
| 123879 | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| DCN1, defective in cullin neddylation 1, domain containing 3 (S. cerevisiae), DCN1-like protein 3, DCUN1 domain-containing protein 3, Defective in cullin neddylation protein 1-like protein 3, DKFZp686O0290, FLJ41725,44M2.4, MGC48972 | |
| Rabbit | |
| 34 kDa | |
| 20 μL | |
| Primary | |
| Human | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction