Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. DCUN1D3 Antibody, Novus Biologicals™

DCUN1D3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15542320 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15542320 20 μL
NBP155423 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15542320 Supplier Novus Biologicals Supplier No. NBP15542320UL

Description

Rabbit Polyclonal Antibody

DCUN1D3 Polyclonal specifically detects DCUN1D3 in Human samples. It is validated for Western Blot.

Specifications

Antigen DCUN1D3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8IWE4
Gene Alias DCN1, defective in cullin neddylation 1, domain containing 3 (S. cerevisiae), DCN1-like protein 3, DCUN1 domain-containing protein 3, Defective in cullin neddylation protein 1-like protein 3, DKFZp686O0290, FLJ41725,44M2.4, MGC48972
Gene Symbols DCUN1D3
Host Species Rabbit
Immunogen Synthetic peptides corresponding to DCUN1D3(DCN1, defective in cullin neddylation 1, domain containing 3 (S. cerevisiae)) The peptide sequence was selected from the C terminal of DCUN1D3. Peptide sequence LNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLS
Molecular Weight of Antigen 34 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 123879
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.