DCUN1D5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP230432

Catalog No. NBP230432

Description

DCUN1D5 Polyclonal specifically detects DCUN1D5 in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: DCUN1D5
• Classification: Polyclonal
• Dilution: Simple Western 1:10, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q9BTE7
• Gene Symbols: DCUN1D5
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MPVKKKRKSPGVAAAVAEDGGLKKCKISSYCRSQPPARLISGEEHFSSKKCLAWF
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae), DCN1-like protein 5, DCUN1 domain-containing protein 5, Defective in cullin neddylation protein 1-like protein 5, FLJ32431, FLJ37425, MGC2714
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84259
• Target Species: Human
• Isotype: IgG

For Research Use Only