Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DDAH2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP158859 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP158859 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP158859 Supplier Novus Biologicals Supplier No. NBP158859
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

DDAH2 Polyclonal antibody specifically detects DDAH2 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin).

Specifications

Antigen DDAH2
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. O95865
Gene Alias DDAHII, dimethylargininase-2, dimethylarginine dimethylaminohydrolase 2G6a, dimethylarginine dimethylaminohydrolase II, EC 3.5.3.18, G6a, N(G), N(G)-dimethylarginine dimethylaminohydrolase 2, NG30, NG-dimethylarginine dimethylamino hydrolase homolog, S-phase protein
Gene Symbols DDAH2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to DDAH2(dimethylarginine dimethylaminohydrolase 2) The peptide sequence was selected from the N terminal of DDAH2 (NP_039268). Peptide sequence MGTPGEGLGRCSHALIRGVPESLASGEGAGAGLPALDLAKAQREHGVLGG.
Molecular Weight of Antigen 30 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 23564
Test Specificity Expected identity based on immunogen sequence: Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Bovine: 92%; Rabbit: 78%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Rabbit
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.