Learn More
Description
Specifications
Specifications
| Antigen | DDR2 |
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunocytochemistry/Immunofluorescence 1-4 ug/ml |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide |
| Gene Alias | CD167 antigen-like family member B, CD167b antigen, Discoidin domain receptor 2, discoidin domain receptor family, member 2, discoidin domain receptor tyrosine kinase 2, discoidin domain-containing receptor 2, EC 2.7.10, EC 2.7.10.1, hydroxyaryl-protein kinase, migration-inducing gene 16 protein, neurotrophic tyrosine kinase receptor related 3, Neurotrophic tyrosine kinase, receptor-related 3, NTRKR3cell migration-inducing protein 20, Receptor protein-tyrosine kinase TKT, TKTMIG20a, TYRO10, Tyrosine-protein kinase TYRO10, tyrosylprotein kinase |
| Gene Symbols | DDR2 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQ |
| Show More |
For Research Use Only
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
