Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DDR2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$393.50 - $670.50
Specifications
Antigen | DDR2 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
DDR2 Polyclonal specifically detects DDR2 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
DDR2 | |
Polyclonal | |
Rabbit | |
Human | |
CD167 antigen-like family member B, CD167b antigen, Discoidin domain receptor 2, discoidin domain receptor family, member 2, discoidin domain receptor tyrosine kinase 2, discoidin domain-containing receptor 2, EC 2.7.10, EC 2.7.10.1, hydroxyaryl-protein kinase, migration-inducing gene 16 protein, neurotrophic tyrosine kinase receptor related 3, Neurotrophic tyrosine kinase, receptor-related 3, NTRKR3cell migration-inducing protein 20, Receptor protein-tyrosine kinase TKT, TKTMIG20a, TYRO10, Tyrosine-protein kinase TYRO10, tyrosylprotein kinase | |
DDR2 | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
4921 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FDRIRNFTTMKVHCNNMFAKGVKIFKEVQCYFRSEASEWEPNAISFPLVLDDVNPSARFVTVPLHHRMASAIKCQ | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title