Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. DDX21 Antibody, Novus Biologicals™

DDX21 Antibody, Novus Biologicals™
SDP

Catalog No. NBP183310 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP183310 0.1 mL
NB433042 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP183310 Supplier Novus Biologicals Supplier No. NBP183310
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 6 publications

DDX21 Polyclonal specifically detects DDX21 in Human, Mouse, Zebrafish samples. It is validated for Western Blot, Chromatin Immunoprecipitation, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, In vitro assay.

Specifications

Antigen DDX21
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000, In vitro assay, Chromatin Immunoprecipitation (ChIP)
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias DEAD (Asp-Glu-Ala-Asp) box polypeptide 21, DEAD box protein 21, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 21, DKFZp686F21172, EC 3.6.1, EC 3.6.4.13, Gu protein, GUA, gu-alpha, GURDB, nucleolar RNA helicase 2, Nucleolar RNA helicase Gu, Nucleolar RNA helicase II, RH II/Gu, RH-II/GU, RH-II/GuA, RNA helicase II/Gu alpha
Gene Symbols DDX21
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KPKSDKTEEIAEEEETVFPKAKQVKKKAEPSEVDMNSPKSKKAKKKEEPSQNDISPKTKSLRKKKEPIEKKVV
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9188
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse, Zebrafish
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.