DDX21 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 6 publications

Catalog Number	Mfr. No.	Quantity
NB433042	Novus Biologicals NBP18331025UL	25 μL
NBP183310	Novus Biologicals NBP183310	0.1 mL

Description

DDX21 Polyclonal specifically detects DDX21 in Human, Mouse, Zebrafish samples. It is validated for Western Blot, Chromatin Immunoprecipitation, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, In vitro assay.

Specifications

• Antigen: DDX21
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 9188
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:KPKSDKTEEIAEEEETVFPKAKQVKKKAEPSEVDMNSPKSKKAKKKEEPSQNDISPKTKSLRKKKEPIEKKVV
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.04-0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000, In vitro assay, Chromatin Immunoprecipitation (ChIP)
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human, Mouse, Zebrafish
• Gene Alias: DEAD (Asp-Glu-Ala-Asp) box polypeptide 21, DEAD box protein 21, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 21, DKFZp686F21172, EC 3.6.1, EC 3.6.4.13, Gu protein, GUA, gu-alpha, GURDB, nucleolar RNA helicase 2, Nucleolar RNA helicase Gu, Nucleolar RNA helicase II, RH II/Gu, RH-II/GU, RH-II/GuA, RNA helicase II/Gu alpha
• Gene Symbols: DDX21
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only