Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DDX25 Antibody, Novus Biologicals™
SDP

Catalog No. NBP1573420 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
20 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP1573420 20 μL
NBP157341 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP1573420 Supplier Novus Biologicals Supplier No. NBP15734120UL

Rabbit Polyclonal Antibody

DDX25 Polyclonal specifically detects DDX25 in Human samples. It is validated for Western Blot.

Specifications

Antigen DDX25
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. Q9UHL0-2
Gene Alias DEAD (Asp-Glu-Ala-Asp) box polypeptide 25, DEAD box protein 25, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 25, EC 3.6.1, EC 3.6.4.13, Gonadotropin-regulated testicular RNA helicase, GRTHATP-dependent RNA helicase DDX25
Gene Symbols DDX25
Host Species Rabbit
Immunogen Synthetic peptides corresponding to DDX25 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 25) The peptide sequence was selected from the C terminal of DDX25. Peptide sequence TVEMIQDGHQVSLLSGELTVEQRASIIQRFRDGKEKVLITTNVCARGIDV.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 29118
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.