Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DDX25 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15734120UL
Description
DDX25 Polyclonal specifically detects DDX25 in Human samples. It is validated for Western Blot.Specifications
DDX25 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
Q9UHL0-2 | |
DDX25 | |
Synthetic peptides corresponding to DDX25 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 25) The peptide sequence was selected from the C terminal of DDX25. Peptide sequence TVEMIQDGHQVSLLSGELTVEQRASIIQRFRDGKEKVLITTNVCARGIDV. | |
20 μL | |
Stem Cell Markers | |
29118 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
DEAD (Asp-Glu-Ala-Asp) box polypeptide 25, DEAD box protein 25, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 25, EC 3.6.1, EC 3.6.4.13, Gonadotropin-regulated testicular RNA helicase, GRTHATP-dependent RNA helicase DDX25 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction