Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DDX31 Antibody, Novus Biologicals™
SDP

Catalog No. NBP157349 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP157349 100 μL
NBP15734920 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP157349 Supplier Novus Biologicals Supplier No. NBP157349
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

DDX31 Polyclonal specifically detects DDX31 in Human samples. It is validated for Western Blot.

Specifications

Antigen DDX31
Applications Western Blot
Classification Polyclonal
Concentration 1 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9H8H2-4
Gene Alias DEAD (Asp-Glu-Ala-Asp) box polypeptide 31, DEAD box protein 31, DEAD/DEXH helicase DDX31, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 31, EC 3.6.1, EC 3.6.4.13, FLJ13633, FLJ14578, FLJ23349, G2 helicase, helicain, probable ATP-dependent RNA helicase DDX31
Gene Symbols DDX31
Host Species Rabbit
Immunogen Synthetic peptides corresponding to DDX31 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 31) The peptide sequence was selected from the N terminal of DDX31. Peptide sequence QASSEAPPAKRRNETSFLPAKKTSVKETQRTFKGNAQKMFSPKKHSVSTS.
Purification Method Protein A purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 64794
Test Specificity Expected identity based on immunogen sequence: Human: 100%; Mouse: 85%; Rat: 78%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Guinea Pig
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.