Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DDX49 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP169713
Description
DDX49 Polyclonal specifically detects DDX49 in Human samples. It is validated for Western Blot.Specifications
DDX49 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
DEAD (Asp-Glu-Ala-Asp) box polypeptide 49, DEAD box protein 49, EC 3.6.1, EC 3.6.4.13, FLJ10432, probable ATP-dependent RNA helicase DDX49, R27090_2 | |
Rabbit | |
53 kDa | |
100 μL | |
Primary | |
Yeast: 77%; Zebrafish: 77%. | |
Human, Mouse, Rat, Canine, Equine, Guinea Pig, Yeast, Zebrafish | |
Purified |
Western Blot | |
1 mg/ml | |
Western Blot 1.0 ug/ml | |
Q9Y6V7 | |
DDX49 | |
Synthetic peptides corresponding to DDX49 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 49) The peptide sequence was selected from the N terminal of DDX49. Peptide sequence ELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVAQALELSRKPHVVIATPGR. | |
Protein A purified | |
RUO | |
54555 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction