Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DDX54 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25782125UL
Description
DDX54 Polyclonal specifically detects DDX54 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
DDX54 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
APR-5, ATP-dependent RNA helicase DP97, DEAD (Asp-Glu-Ala-Asp) box polypeptide 54, DEAD box helicase 97 KDa, DEAD box protein 54, DEAD box RNA helicase 97 kDa, DP97ATP-dependent RNA helicase DDX54, EC 3.6.1, EC 3.6.4.13, MGC2835 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
DDX54 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TAYSLVAPDEIPYLLDLHLFLGRSLTLARPLKEPSGVAGVDGMLGRVPQSVVDEEDSGLQSTLEASLELRGLARVADNAQQQYV | |
25 μL | |
Signal Transduction | |
79039 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction