Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DDX54 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | DDX54 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
DDX54 Polyclonal specifically detects DDX54 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
DDX54 | |
Polyclonal | |
Rabbit | |
Signal Transduction | |
APR-5, ATP-dependent RNA helicase DP97, DEAD (Asp-Glu-Ala-Asp) box polypeptide 54, DEAD box helicase 97 KDa, DEAD box protein 54, DEAD box RNA helicase 97 kDa, DP97ATP-dependent RNA helicase DDX54, EC 3.6.1, EC 3.6.4.13, MGC2835 | |
DDX54 | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
79039 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TAYSLVAPDEIPYLLDLHLFLGRSLTLARPLKEPSGVAGVDGMLGRVPQSVVDEEDSGLQSTLEASLELRGLARVADNAQQQYV | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title