DDX56 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP180990	0.1 mL

Catalog No. NBP180990 Supplier Novus Biologicals Supplier No. NBP180990

Description

Rabbit Polyclonal Antibody

DDX56 Polyclonal specifically detects DDX56 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: DDX56
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Classification: Polyclonal
• Conjugate: Unconjugated
• Dilution: Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Accession No.: Q9NY93
• Gene Alias: ATP-dependent 61 kDa nucleolar RNA helicase, DDX26, DEAD (Asp-Glu-Ala-Asp) box polypeptide 56, DEAD box protein 21, DEAD box protein 56, DEAD-box RNA helicase, EC 3.6.1, EC 3.6.4.13,61-kd nucleolar helicase, NOH61DDX21, probable ATP-dependent RNA helicase DDX56, putative nucleolar RNA helicase
• Gene Symbols: DDX56
• Host Species: Rabbit
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:TGPVVEQAVRGLVLVPTKELARQAQSMIQQLATYCARDVRVANVSAAEDSVSQRAVLMEKPDVVVGTPSRILSHLQQDSLKLRDS
• Purification Method: Affinity Purified
• Quantity: 0.1 mL
• Regulatory Status: RUO
• Research Discipline: DNA replication Transcription Translation and Splicing
• Primary or Secondary: Primary
• Gene ID (Entrez): 54606
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Target Species: Human, Mouse, Rat
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only