Decorin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25634625UL

Catalog No. NB394528

Description

Decorin Polyclonal specifically detects Decorin in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Decorin
• Classification: Polyclonal
• Dilution: Western Blot 0.04-0.4 μg/mL, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: Bone proteoglycan II, CSCD, decorin, decorin proteoglycan, dermatan sulphate proteoglycans II, DSPG2, PG40, PGII, PG-S2, proteoglycan core protein, SLRR1BPGS2, small leucine-rich protein 1B
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: DCN
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VSPGAFTPLVKLERLYLSKNQLKELPEKMPKTLQELRAHENEITKVRKVTFNGLNQMIVIELGTNPLKSSGIENGAFQGMKKLSY
• Quantity: 25 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 1634
• Target Species: Human
• Form: Purified

For Research Use Only