DECR2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP153172

Catalog No. NBP153172

Description

DECR2 Polyclonal specifically detects DECR2 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: DECR2
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: 2,4-dienoyl CoA reductase 2, peroxisomal, EC 1.3.1, EC 1.3.1.34, pDCR2,4-dienoyl-CoA reductase 2, PDCRshort chain dehydrogenase/reductase family 17C, member 1, peroxisomal 2,4-dienoyl-CoA reductase, SDR17C1
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Chicken: 100%; Canine: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NUI1
• Gene Symbols: DECR2
• Immunogen: Synthetic peptides corresponding to DECR2(2,4-dienoyl CoA reductase 2, peroxisomal) The peptide sequence was selected from the N terminal of DECR2. Peptide sequence MAQPPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMR.
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 26063
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG