Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DECR2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | DECR2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
Description
DECR2 Polyclonal specifically detects DECR2 in Human samples. It is validated for Western Blot.Specifications
| DECR2 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Q9NUI1 | |
| 26063 | |
| Synthetic peptides corresponding to DECR2(2,4-dienoyl CoA reductase 2, peroxisomal) The peptide sequence was selected from the N terminal of DECR2. Peptide sequence MAQPPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMR. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Lipid and Metabolism | |
| 2,4-dienoyl CoA reductase 2, peroxisomal, EC 1.3.1, EC 1.3.1.34, pDCR2,4-dienoyl-CoA reductase 2, PDCRshort chain dehydrogenase/reductase family 17C, member 1, peroxisomal 2,4-dienoyl-CoA reductase, SDR17C1 | |
| DECR2 | |
| IgG | |
| Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title