Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Dectin-2/CLEC6A Antibody, Novus Biologicals™
SDP

Catalog No. NBP15973920 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15973920 20 μL
NBP159739 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15973920 Supplier Novus Biologicals Supplier No. NBP15973920UL

Rabbit Polyclonal Antibody

Dectin-2/CLEC6A Polyclonal specifically detects Dectin-2/CLEC6A in Human samples. It is validated for Western Blot.

Specifications

Antigen Dectin-2/CLEC6A
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q6EIG7
Gene Alias CLEC4N, CLECSF10, C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamilymember 10, C-type lectin domain family 6 member A, C-type lectin domain family 6, member A, C-type lectin superfamily member 10, DC-associated C-type lectin 2, dectin 2, Dectin-2, DECTIN2, Dendritic cell-associated C-type lectin 2
Gene Symbols CLEC6A
Host Species Rabbit
Immunogen Synthetic peptides corresponding to CLEC6A(C-type lectin domain family 6, member A) Antibody(against the N terminal of CLEC6A (NP_001007034). Peptide sequence FIVSCVVTYHFTYGETGKRLSELHSYHSSLTCFSEGTKVPAWGCCPASWK.
Molecular Weight of Antigen 24 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 93978
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.