Dectin-2/CLEC6A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15973920UL

Catalog No. NBP15973920

Description

Dectin-2/CLEC6A Polyclonal specifically detects Dectin-2/CLEC6A in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Dectin-2/CLEC6A
• Classification: Polyclonal
• Dilution: Western Blot 0.2-1 ug/ml
• Gene Accession No.: Q6EIG7
• Gene Symbols: CLEC6A
• Immunogen: Synthetic peptides corresponding to CLEC6A(C-type lectin domain family 6, member A) Antibody(against the N terminal of CLEC6A (NP_001007034). Peptide sequence FIVSCVVTYHFTYGETGKRLSELHSYHSSLTCFSEGTKVPAWGCCPASWK.
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 93978
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CLEC4N, CLECSF10, C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamilymember 10, C-type lectin domain family 6 member A, C-type lectin domain family 6, member A, C-type lectin superfamily member 10, DC-associated C-type lectin 2, dectin 2, Dectin-2, DECTIN2, Dendritic cell-associated C-type lectin 2
• Host Species: Rabbit
• Molecular Weight of Antigen: 24 kDa
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Human
• Isotype: IgG