Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Dectin-2/CLEC6A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | Dectin-2/CLEC6A |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15973920
|
Novus Biologicals
NBP15973920UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP159739
|
Novus Biologicals
NBP159739 |
100 μL |
Each for $487.50
|
|
|||||
Description
Dectin-2/CLEC6A Polyclonal specifically detects Dectin-2/CLEC6A in Human samples. It is validated for Western Blot.Specifications
| Dectin-2/CLEC6A | |
| Polyclonal | |
| Rabbit | |
| Q6EIG7 | |
| 93978 | |
| Synthetic peptides corresponding to CLEC6A(C-type lectin domain family 6, member A) Antibody(against the N terminal of CLEC6A (NP_001007034). Peptide sequence FIVSCVVTYHFTYGETGKRLSELHSYHSSLTCFSEGTKVPAWGCCPASWK. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| CLEC4N, CLECSF10, C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamilymember 10, C-type lectin domain family 6 member A, C-type lectin domain family 6, member A, C-type lectin superfamily member 10, DC-associated C-type lectin 2, dectin 2, Dectin-2, DECTIN2, Dendritic cell-associated C-type lectin 2 | |
| CLEC6A | |
| IgG | |
| 24 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title