Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DEFB104A Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier: Novus Biologicals NBP25979225UL

View more versions of this product

Catalog No. NB393133

$382.00 / Each of 1

Already have an account? Sign In to view your price. New here? Register with us today!

Qty

Add to Cart

Description

DEFB104A Polyclonal specifically detects DEFB104A in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	DEFB104A
Classification	Polyclonal
Dilution	Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias	DEFB104B, DEFB-4, defensin, beta 104A, defensin, beta 4
Host Species	Rabbit
Purification Method	Protein A purified
Regulatory Status	RUO
Gene ID (Entrez)	140596
Target Species	Human
Form	Purified

Applications	Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Formulation	PBS (pH 7.2), containing 40% glycerol with 0.02% Sodium Azide
Gene Symbols	DEFB104A
Immunogen	This antibody was developed against a recombinant protein corresponding to the amino acid sequence:EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRT
Quantity	25 μL
Primary or Secondary	Primary
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage	Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
Isotype	IgG

Product Suggestions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

For Research Use Only (RUO)

Spot an opportunity for improvement?Share a Content Correction

DEFB104A Antibody, Novus Biologicals™

Description

Specifications

Product Suggestions

Documents

Promotions