Learn More
Description
Specifications
Specifications
| Antigen | DEGS2 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | C14orf66, chromosome 14 open reading frame 66, Degenerative spermatocyte homolog 2, degenerative spermatocyte homolog 2, lipid desaturase (Drosophila), DES2sphingolipid delta(4)-desaturase/C4-hydroxylase DES2, EC 1.14, FADS8, sphingolipid C4-hydroxylase/delta 4-desaturase, sphingolipid delta 4 desaturase/C-4 hydroxylase |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of mouse DEGS2 (NP_001164473.1). Peptide sequence TFNVGYHMEHHDFPSIPGYYLPLVRKIAPEYYDHLPQHHSWVKVLWDFVF |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
