Dehydrodolichyl Diphosphate Synthase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP18497525UL

Catalog No. NB432416

Description

Dehydrodolichyl Diphosphate Synthase Polyclonal specifically detects Dehydrodolichyl Diphosphate Synthase in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: Dehydrodolichyl Diphosphate Synthase
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:10-1:20
• Gene Alias: cis-isoprenyltransferase, cis-prenyl transferase, CIT, CPT, Dedol-PP synthase, dehydrodolichyl diphosphate synthase, EC 2.5.1.-, FLJ13102, HDSDS
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 79947
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: DHDDS
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:RSKSEVDGLMDLARQKFSRLMEEKEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKNYNKCFLNVCFAYTSRHEISNA
• Quantity: 25ul
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only