Dehydrodolichyl Diphosphate Synthase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155231

Catalog No. NBP155231

Description

Dehydrodolichyl Diphosphate Synthase Polyclonal specifically detects Dehydrodolichyl Diphosphate Synthase in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Dehydrodolichyl Diphosphate Synthase
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: cis-isoprenyltransferase, cis-prenyl transferase, CIT, CPT, Dedol-PP synthase, dehydrodolichyl diphosphate synthase, EC 2.5.1.-, FLJ13102, HDSDS
• Host Species: Rabbit
• Molecular Weight of Antigen: 39 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q86SQ9
• Gene Symbols: DHDDS
• Immunogen: Synthetic peptides corresponding to DHDDS(dehydrodolichyl diphosphate synthase) The peptide sequence was selected from the N terminal of DHDDS. Peptide sequence NRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKR.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 79947
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG