Deoxycytidylate deaminase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157825

Catalog No. NBP157825

Description

Deoxycytidylate deaminase Polyclonal specifically detects Deoxycytidylate deaminase in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Deoxycytidylate deaminase
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: dCMP deaminaseEC 3.5.4.12, deoxycytidylate deaminase, MGC111062
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: D3DP49
• Gene Symbols: DCTD
• Immunogen: Synthetic peptides corresponding to DCTD(dCMP deaminase) The peptide sequence was selected from the middle region of DCTD. Peptide sequence MSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKL.
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 1635
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit
• Isotype: IgG