Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Deoxycytidylate deaminase Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Deoxycytidylate deaminase |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Deoxycytidylate deaminase Polyclonal specifically detects Deoxycytidylate deaminase in Human samples. It is validated for Western Blot.Specifications
Deoxycytidylate deaminase | |
Polyclonal | |
Rabbit | |
Lipid and Metabolism | |
dCMP deaminaseEC 3.5.4.12, deoxycytidylate deaminase, MGC111062 | |
DCTD | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
D3DP49 | |
1635 | |
Synthetic peptides corresponding to DCTD(dCMP deaminase) The peptide sequence was selected from the middle region of DCTD. Peptide sequence MSDKYHDSDEATAARLLFNMAGVTFRKFIPKCSKIVIDFDSINSRPSQKL. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title