DEPDC1B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256444

Catalog No. NBP256444

Description

DEPDC1B Polyclonal specifically detects DEPDC1B in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: DEPDC1B
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: BRCC3, breast cancer cell 3, DEP domain containing 1B, DEP domain-containing protein 1B, FLJ11252, HBV XAg-transactivated protein 8, HBV X-transactivated gene 8 protein, HBxAg transactivated protein 1, XTP1, XTP8
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: DEPDC1B
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IGEVPACRLVHRRQLTEANVEEIWKSMTLSYLQKILGLDSLEEVLDVKLVNSKFIIHNVYSVSKQGVVILDDKSKELPHW
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 55789
• Target Species: Human
• Isotype: IgG

For Research Use Only