DFF40/CAD Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP255648

Catalog No. NBP255648

Description

DFF40/CAD Polyclonal specifically detects DFF40/CAD in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: DFF40/CAD
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: CADCaspase-activated nuclease, Caspase-activated deoxyribonuclease, Caspase-activated DNase, CPANDNA fragmentation factor 40 kDa subunit, DFF-40DFF40DFF2DNA fragmentation factor subunit beta, DNA fragmentation factor, 40kDa, beta polypeptide (caspase-activated DNase), EC 3.-
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: DFFB
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EAQEEFLRVLGSMCQRLRSMQYNGSYFDRGAKGGSRLCTPEGWFSCQGPFDMDSCLSRHSINPYSNRESRILFSTWN
• Quantity: 100 μL
• Research Discipline: Apoptosis
• Gene ID (Entrez): 1677
• Target Species: Human
• Isotype: IgG

For Research Use Only