Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DGAT1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | DGAT1 |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NB126845
|
Novus Biologicals
NBP310973100UL |
100 μg |
Each of 1 for $482.50
|
|
|||||
Description
DGAT1 Polyclonal specifically detects DGAT1 in Mouse samples. It is validated for Western Blot.Specifications
DGAT1 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Cancer, Diabetes Research, Lipid and Metabolism, Lipid Droplets, Signal Transduction | |
PBS buffer, 2% sucrose | |
8694 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
Mouse | |
ACAT-related gene product 1, AGRP1, ARGP1acyl coenzyme A:cholesterol acyltransferase related gene 1, DGATACAT related gene product 1, diacylglycerol O-acyltransferase 1, diacylglycerol O-acyltransferase homolog 1, diacylglycerol O-acyltransferase homolog 1 (mouse), Diglyceride acyltransferase, EC 2.3.1, EC 2.3.1.20 | |
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse DGAT1 (NP_034176). Peptide sequence HRLQDSLFSSDSGFSNYRGILNWCVVMLILSNARLFLENLIKYGILVDPI | |
Affinity purified |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title