Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DGAT1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$106.19 - $352.89

Specifications

Antigen DGAT1
Dilution Western Blot 1.0 ug/ml
Applications Western Blot
Conjugate Unconjugated
Format Purified
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NB126846
View Documents
Novus Biologicals
NBP31097325UL
25 μg
Each for $106.19
Add to cart
 
NB126845
View Documents
Novus Biologicals
NBP310973100UL
100 μg
Each for $352.89
Add to cart
 
Description

Description

DGAT1 Polyclonal antibody specifically detects DGAT1 in Mouse samples. It is validated for Western Blot
Specifications

Specifications

DGAT1
Western Blot
Purified
RUO
Mouse
ACAT-related gene product 1, AGRP1, ARGP1acyl coenzyme A:cholesterol acyltransferase related gene 1, DGATACAT related gene product 1, diacylglycerol O-acyltransferase 1, diacylglycerol O-acyltransferase homolog 1, diacylglycerol O-acyltransferase homolog 1 (mouse), Diglyceride acyltransferase, EC 2.3.1, EC 2.3.1.20
The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse DGAT1 (NP_034176). Peptide sequence HRLQDSLFSSDSGFSNYRGILNWCVVMLILSNARLFLENLIKYGILVDPI
Primary
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Western Blot 1.0 ug/ml
Unconjugated
Rabbit
Cancer, Diabetes Research, Lipid and Metabolism, Lipid Droplets, Signal Transduction
PBS buffer, 2% sucrose
8694
Polyclonal
Affinity purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit