Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DGAT1 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | DGAT1 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
DGAT1 Polyclonal specifically detects DGAT1 in Mouse samples. It is validated for Western Blot.Specifications
| DGAT1 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Cancer, Diabetes Research, Lipid and Metabolism, Lipid Droplets, Signal Transduction | |
| PBS buffer, 2% sucrose | |
| 8694 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| Mouse | |
| ACAT-related gene product 1, AGRP1, ARGP1acyl coenzyme A:cholesterol acyltransferase related gene 1, DGATACAT related gene product 1, diacylglycerol O-acyltransferase 1, diacylglycerol O-acyltransferase homolog 1, diacylglycerol O-acyltransferase homolog 1 (mouse), Diglyceride acyltransferase, EC 2.3.1, EC 2.3.1.20 | |
| The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse DGAT1 (NP_034176). Peptide sequence HRLQDSLFSSDSGFSNYRGILNWCVVMLILSNARLFLENLIKYGILVDPI | |
| Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title