DGK-epsilon Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159067

Catalog No. NBP159067

Description

DGK-epsilon Polyclonal specifically detects DGK-epsilon in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: DGK-epsilon
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DAG kinase epsilon, DAGK5, DAGK6, DGK, DGK-epsilon, diacylglycerol kinase epsilon, diacylglycerol kinase, epsilon (64kD), diacylglycerol kinase, epsilon 64kDa, Diglyceride kinase epsilon, EC 2.7.1.107
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%.
• Target Species: Human, Mouse, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P52429
• Gene Symbols: DGKE
• Immunogen: Synthetic peptides corresponding to DGKE(diacylglycerol kinase, epsilon 64kDa) The peptide sequence was selected from the N terminal of DGKE. Peptide sequence EAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHR.
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 8526
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.