Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DGK-epsilon Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159067

 View more versions of this product

Catalog No. NBP159067


Only null left
Add to Cart

Description

Description

DGK-epsilon Polyclonal specifically detects DGK-epsilon in Human, Mouse samples. It is validated for Western Blot.
Specifications

Specifications

DGK-epsilon
Polyclonal
Unconjugated
PBS, 2% Sucrose with 0.09% Sodium Azide
DAG kinase epsilon, DAGK5, DAGK6, DGK, DGK-epsilon, diacylglycerol kinase epsilon, diacylglycerol kinase, epsilon (64kD), diacylglycerol kinase, epsilon 64kDa, Diglyceride kinase epsilon, EC 2.7.1.107
Rabbit
Affinity purified
RUO
Primary
Expected identity based on immunogen sequence: Human: 100%.
Human, Mouse, Rabbit
IgG
Western Blot
0.5 mg/ml
Western Blot 1.0 ug/ml
P52429
DGKE
Synthetic peptides corresponding to DGKE(diacylglycerol kinase, epsilon 64kDa) The peptide sequence was selected from the N terminal of DGKE. Peptide sequence EAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHR.
100 μL
Lipid and Metabolism
8526
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.