Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DGK-epsilon Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen DGK-epsilon
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP159067
View Documents
Novus Biologicals
NBP159067
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

DGK-epsilon Polyclonal specifically detects DGK-epsilon in Human, Mouse samples. It is validated for Western Blot.
Specifications

Specifications

DGK-epsilon
Polyclonal
Rabbit
Lipid and Metabolism
P52429
8526
Synthetic peptides corresponding to DGKE(diacylglycerol kinase, epsilon 64kDa) The peptide sequence was selected from the N terminal of DGKE. Peptide sequence EAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHR.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
PBS and 2% Sucrose with 0.09% Sodium Azide
DAG kinase epsilon, DAGK5, DAGK6, DGK, DGK-epsilon, diacylglycerol kinase epsilon, diacylglycerol kinase, epsilon (64kD), diacylglycerol kinase, epsilon 64kDa, Diglyceride kinase epsilon, EC 2.7.1.107
DGKE
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit