Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DGK-epsilon Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | DGK-epsilon |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP159067
|
Novus Biologicals
NBP159067 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
DGK-epsilon Polyclonal specifically detects DGK-epsilon in Human, Mouse samples. It is validated for Western Blot.Specifications
| DGK-epsilon | |
| Polyclonal | |
| Rabbit | |
| Lipid and Metabolism | |
| P52429 | |
| 8526 | |
| Synthetic peptides corresponding to DGKE(diacylglycerol kinase, epsilon 64kDa) The peptide sequence was selected from the N terminal of DGKE. Peptide sequence EAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHR. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| DAG kinase epsilon, DAGK5, DAGK6, DGK, DGK-epsilon, diacylglycerol kinase epsilon, diacylglycerol kinase, epsilon (64kD), diacylglycerol kinase, epsilon 64kDa, Diglyceride kinase epsilon, EC 2.7.1.107 | |
| DGKE | |
| IgG | |
| Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title