Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DHODH Antibody, Novus Biologicals™
SDP

Catalog No. NBP15958420 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15958420 20 μL
NBP159584 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15958420 Supplier Novus Biologicals Supplier No. NBP15958420UL

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Rabbit Polyclonal Antibody

DHODH Polyclonal specifically detects DHODH in Human samples. It is validated for Western Blot.

Specifications

Antigen DHODH
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. Q02127
Gene Alias DHOdehase, dihydroorotate dehydrogenase, dihydroorotate dehydrogenase, mitochondrial, Dihydroorotate oxidase, EC 1.3.3.1, EC 1.3.5.2, human complement of yeast URA1, POADS, URA1
Gene Symbols DHODH
Host Species Rabbit
Immunogen Synthetic peptides corresponding to DHODH(dihydroorotate dehydrogenase) The peptide sequence was selected from the N terminal of DHODH. Peptide sequence GEAVDGLYKMGFGFVEIGSVTPKPQEGNPRPRVFRLPEDQAVINRYGFNS.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1723
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.