DHRS3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179192

Catalog No. NBP179192

Description

DHRS3 Polyclonal specifically detects DHRS3 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: DHRS3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DD83.1, dehydrogenase/reductase (SDR family) member 3, EC 1.1.1, EC 1.1.1.300, RDH17, Retinal short-chain dehydrogenase/reductase 1, RETSDR1, retSDR1short chain dehydrogenase/reductase family 16C, member 1, Rsdr1, SDR1, SDR16C1, short-chain dehydrogenase/reductase 1, short-chain dehydrogenase/reductase 3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9249
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_035433
• Gene Symbols: DHRS3
• Immunogen: The immunogen for this antibody is Dhrs3. Peptide sequence PGVSATTVLPFHTSTEMFQGMRVRFPNLFPPLKPETVARRTVDAVQQNQA.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Canine: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Guinea pig: 92%; Mouse: 92%; Xenopus: 78%; Zebrafish: 78%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG