Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DHRS3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | DHRS3 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
DHRS3 Polyclonal specifically detects DHRS3 in Mouse samples. It is validated for Western Blot.Specifications
DHRS3 | |
Polyclonal | |
Rabbit | |
NP_035433 | |
9249 | |
The immunogen for this antibody is Dhrs3. Peptide sequence PGVSATTVLPFHTSTEMFQGMRVRFPNLFPPLKPETVARRTVDAVQQNQA. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
DD83.1, dehydrogenase/reductase (SDR family) member 3, EC 1.1.1, EC 1.1.1.300, RDH17, Retinal short-chain dehydrogenase/reductase 1, RETSDR1, retSDR1short chain dehydrogenase/reductase family 16C, member 1, Rsdr1, SDR1, SDR16C1, short-chain dehydrogenase/reductase 1, short-chain dehydrogenase/reductase 3 | |
DHRS3 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title