Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

DHRS7 Antibody, Novus Biologicals™
SDP

Catalog No. NBP16891320 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
20 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16891320 20 μL
NBP168913 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP16891320 Supplier Novus Biologicals Supplier No. NBP16891320UL

Item Discontinued This item has been discontinued by the supplier. Please to view product availability in your area.

Rabbit Polyclonal Antibody

DHRS7 Polyclonal specifically detects DHRS7 in Mouse samples. It is validated for Western Blot.

Specifications

Antigen DHRS7
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias dehydrogenase/reductase (SDR family) member 7,2310016E22Rik, dehydrogenase/reductase SDR family member 7, DHRS7A, EC 1.1, retDSR4, Retinal short-chain dehydrogenase/reductase 4, RETSDR4, SDR34C1, short chain dehydrogenase/reductase family 34C, member 1
Gene Symbols DHRS7
Host Species Rabbit
Immunogen Synthetic peptides corresponding to Dhrs7 (dehydrogenase/reductase (SDR family) member 7) The peptide sequence was selected from the N terminal of Dhrs7. Peptide sequence MVVWVTGASSGIGEELAFQLSKLGVSLVLSARRAQELERVKRRCLENGNL.
Molecular Weight of Antigen 30 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 51635
Target Species Mouse
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.