Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP16257220

DHRS7B Antibody, Novus Biologicals™
SDP

Catalog No. NBP16257220 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16257220 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP16257220 Supplier Novus Biologicals Supplier No. NBP16257220UL

Description

Rabbit Polyclonal Antibody

DHRS7B Polyclonal specifically detects DHRS7B in Human samples. It is validated for Western Blot.

Specifications

Antigen DHRS7B
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q6IAN0
Gene Alias CGI-93, dehydrogenase/reductase (SDR family) member 7B, dehydrogenase/reductase SDR family member 7B, DKFZp566O084, EC 1.1, MGC8916, SDR32C1, short chain dehydrogenase/reductase family 32C, member 1
Gene Symbols DHRS7B
Host Species Rabbit
Immunogen Synthetic peptides corresponding to DHRS7B(dehydrogenase/reductase (SDR family) member 7B) The peptide sequence was selected form the middle region of DHRS7B. Peptide sequence QAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAITADGSRYGVMDTTTA.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline Lipid and Metabolism
Primary or Secondary Primary
Gene ID (Entrez) 25979
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.