DHRS7B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169584

Catalog No. NBP169584

Description

DHRS7B Polyclonal specifically detects DHRS7B in Human samples. It is validated for Western Blot.

Specifications

• Antigen: DHRS7B
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CGI-93, dehydrogenase/reductase (SDR family) member 7B, dehydrogenase/reductase SDR family member 7B, DKFZp566O084, EC 1.1, MGC8916, SDR32C1, short chain dehydrogenase/reductase family 32C, member 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 35 kDa
• Quantity: 100 μL
• Research Discipline: Lipid and Metabolism
• Gene ID (Entrez): 25979
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q6IAN0
• Gene Symbols: DHRS7B
• Immunogen: Synthetic peptides corresponding to DHRS7B(dehydrogenase/reductase (SDR family) member 7B) The peptide sequence was selected from the middle region of DHRS7B. Peptide sequence QAFFDCLRAEMEQYEIEVTVISPGYIHTNLSVNAITADGSRYGVMDTTTA.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Canine: 86%; Bovine: 86%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Guinea Pig, Rabbit
• Isotype: IgG

For Research Use Only