DHX32 Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP157347	100 μL

Catalog No. NBP157347 Supplier Novus Biologicals Supplier No. NBP157347

Description

Rabbit Polyclonal Antibody

DHX32 Polyclonal specifically detects DHX32 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: DHX32
• Applications: Western Blot
• Classification: Polyclonal
• Concentration: 0.5 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: Q7L7V1
• Gene Alias: DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 32, DEAD/H box 32, DEAD/H helicase-like protein 1, DEAH (Asp-Glu-Ala-His) box polypeptide 32, DEAH box protein 32, DHLP1DDX32DEAD/H helicase-like protein-1, EC 3.6.1, EC 3.6.4.13, FLJ10694, FLJ10889, huDDX32, putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32
• Gene Symbols: DHX32
• Host Species: Rabbit
• Immunogen: Synthetic peptides corresponding to DHX32(DEAH (Asp-Glu-Ala-His) box polypeptide 32) The peptide sequence was selected from the N terminal of DHX32. Peptide sequence EEEGLECPNSSSEKRYFPESLDSSDGDEEEVLACEDLELNPFDGLPYSSR.
• Purification Method: Affinity purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 55760
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Human: 100%; Pig: 100%; Guinea pig: 92%; Mouse: 92%; Rabbit: 92%; Rat: 92%.
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only