DHX34 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157294

Catalog No. NBP157294

Description

DHX34 Polyclonal specifically detects DHX34 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: DHX34
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: DHX34
• Immunogen: Synthetic peptides corresponding to DHX34(DEAH (Asp-Glu-Ala-His) box polypeptide 34) The peptide sequence was selected from the middle region of DHX34. Peptide sequence VPGRLFPITVVYQPQEAEPTTSKSEKLDPRPFLRVLESIDHKYPPEERGD.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Equine: 100%; Human: 100%; Rabbit: 100%; Canine: 85%; Guinea pig: 78%; Mouse: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: DDX34, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 34, DEAH (Asp-Glu-Ala-His) box polypeptide 34, DEAH box protein 34, HRH1, KIAA0134
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9704
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.