Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DHX34 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15729420UL
Description
DHX34 Polyclonal specifically detects DHX34 in Human samples. It is validated for Western Blot.Specifications
DHX34 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
DDX34, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 34, DEAH (Asp-Glu-Ala-His) box polypeptide 34, DEAH box protein 34, HRH1, KIAA0134 | |
Rabbit | |
Affinity Purified | |
RUO | |
9704 | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS & 2% Sucrose. with No Preservative | |
DHX34 | |
Synthetic peptides corresponding to DHX34(DEAH (Asp-Glu-Ala-His) box polypeptide 34) The peptide sequence was selected from the middle region of DHX34. Peptide sequence VPGRLFPITVVYQPQEAEPTTSKSEKLDPRPFLRVLESIDHKYPPEERGD. | |
20 μL | |
Primary | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction