Learn More
Description
Specifications
Specifications
| Antigen | DHX34 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:100-1:2000 |
| Formulation | PBS & 2% Sucrose. with No Preservative |
| Gene Alias | DDX34, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 34, DEAH (Asp-Glu-Ala-His) box polypeptide 34, DEAH box protein 34, HRH1, KIAA0134 |
| Gene Symbols | DHX34 |
| Host Species | Rabbit |
| Immunogen | Synthetic peptides corresponding to DHX34(DEAH (Asp-Glu-Ala-His) box polypeptide 34) The peptide sequence was selected from the middle region of DHX34. Peptide sequence VPGRLFPITVVYQPQEAEPTTSKSEKLDPRPFLRVLESIDHKYPPEERGD. |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
