Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
DHX35 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15734820UL
Description
DHX35 Polyclonal specifically detects DHX35 in Human samples. It is validated for Western Blot.Specifications
| DHX35 | |
| Polyclonal | |
| Western Blot 1:100-1:2000 | |
| Q9H5Z1 | |
| DHX35 | |
| Synthetic peptides corresponding to DHX35(DEAH (Asp-Glu-Ala-His) box polypeptide 35) The peptide sequence was selected from the N terminal of DHX35. Peptide sequence MAAPVGPVKFWRPGTEGPGVSISEERQSLAENSGTTVVYNPYAALSIEQQ. | |
| 20 μL | |
| Primary | |
| Human | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS & 2% Sucrose. with No Preservative | |
| C20orf15, DDX35, DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 35, DEAH (Asp-Glu-Ala-His) box polypeptide 35, DEAH box protein 35, DEAH-box protein 35, EC 3.6.1, EC 3.6.4.13, FLJ22759, KAIA0875, probable ATP-dependent RNA helicase DHX35 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 60625 | |
| Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction