Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. DHX58 Antibody, Novus Biologicals™

DHX58 Antibody, Novus Biologicals™
SDP

Catalog No. NBP185348 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP185348 0.1 mL
NB406637 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP185348 Supplier Novus Biologicals Supplier No. NBP185348
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody has been used in 1 publication

DHX58 Polyclonal specifically detects DHX58 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen DHX58
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500-1:1000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias D11lgp2e, D11LGP2probable ATP-dependent RNA helicase DHX58, DEXH (Asp-Glu-X-His) box polypeptide 58, EC 3.6.4.13, LGP2ortholog of mouse D11lgp2, Probable ATP-dependent helicase LGP2, Protein D11Lgp2 homolog, RIG-I-like receptor LGP2, RLR, RNA helicase LGP2
Gene Symbols DHX58
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:AINHVLQLCANLDTWCIMSPQNCCPQLQEHSQQPCKQYNLCHRRSQDPFGDLLKKLMDQIHDHLEMPELSRKFGTQMYEQQVVKLS
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 79132
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.