Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Dicer Antibody (CL0378), Novus Biologicals™
SDP

Catalog No. NBP230699 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP230699 0.1 mL
NB437457 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP230699 Supplier Novus Biologicals Supplier No. NBP230699
Add to Cart
Add to Cart

Mouse Monoclonal Antibody has been used in 1 publication

Dicer Monoclonal specifically detects Dicer in Human, Virus samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

Antigen Dicer
Applications Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Monoclonal
Clone CL0378
Conjugate Unconjugated
Dilution Western Blot 1 μg/mL, Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 2-10 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500, Knockdown Validated
Gene Accession No. Q9UPY3
Gene Alias DCR1, Dicer, dicer 1, double-stranded RNA-specific endoribonuclease, dicer 1, ribonuclease type III, Dicer1, Dcr-1 homolog (Drosophila), EC 3.1.26, EC 3.1.26.-, EC 3.1.26.3, Helicase MOI, Helicase with RNase motif, helicase-moi, HERNADicer1, Dcr-1 homolog, K12H4.8-LIKE, KIAA0928endoribonuclease Dicer
Gene Symbols DICER1
Host Species Mouse
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: PTDADSAYCVLPLNVVNDSSTLDIDFKFMEDIEKSEARIGIPSTKYTKETPFVFKLEDYQDAVIIPRYRNFDQPHRFYVADVYTDLTPLSKFPSPEYETFAEYYKTKYNLDLTNLNQPLLDVDHTSSRLNLLTPRHLNQKGKALPLSSAEKRKAKWESLQNKQILVPELCAIHPIPASLWRKAVCLPSILYRLH
Purification Method Protein A purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Apoptosis, Cell Biology, Cell Cycle and Replication, Chromatin Research, Cytokine Research, Epigenetics, Immunology, Innate Immunity, microRNA, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 23405
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Virus
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG2a
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.