Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Rabbit anti-Human, Rat, Clone: 1Q5F6, Novus Biologicals™
SDP

Catalog No. NB167979 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB167979 100 μg
NB167980 20 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Catalog No. NB167979 Supplier Novus Biologicals Supplier No. NBP316444100UL
Add to Cart
Add to Cart
This item is not returnable. View return policy

Rabbit Monoclonal Antibody

Dimethylarginine Dimethylaminohydrolase 1/DDAH1 Monoclonal antibody specifically detects Dimethylarginine Dimethylaminohydrolase 1/DDAH1 in Human, Rat samples. It is validated for Western Blot

Specifications

Antigen Dimethylarginine Dimethylaminohydrolase 1/DDAH1
Applications Western Blot
Classification Monoclonal
Clone 1Q5F6
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias DDAH-1, DDAHdimethylargininase-1, DDAHI, Dimethylargininase-1, dimethylarginine dimethylaminohydrolase 1FLJ25539, EC 3.5.3.18, FLJ21264, N(G), N(G)-dimethylarginine dimethylaminohydrolase 1, NG, NG-dimethylarginine dimethylaminohydrolase
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 186-285 of human Dimethylarginine Dimethylaminohydrolase 1/DDAH1 (O94760). IAIGSSESAQKALKIMQQMSDHRYDKLTVPDDIAANCIYLNIPNKGHVLLHRTPEEYPESAKVYEKLKDHMLIPVSMSELEKVDGLLTCCSVLINKKVDS
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 23576
Target Species Human, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.